PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.IXX59
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 97aa    MW: 11636.4 Da    PI: 10.3957
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.IXX59genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+ eEd++l+  v+++G  +W+  ++  g+ R++k+c++rw++yl
      Aradu.IXX59 14 KGAWSREEDQRLIAFVQRYGHSNWRQLPKFAGLARCGKSCRLRWLNYL 61
                     79*********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-22864IPR009057Homeodomain-like
PROSITE profilePS5129422.004965IPR017930Myb domain
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002498.4E-161461IPR001005SANT/Myb domain
SuperFamilySSF466893.4E-241590IPR009057Homeodomain-like
CDDcd001672.52E-101661No hitNo description
PROSITE profilePS500904.7046297IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.7E-106589IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MVRAPFYDKY GVKKGAWSRE EDQRLIAFVQ RYGHSNWRQL PKFAGLARCG KSCRLRWLNY  60
LRPNLKHGNY TQEEEELIIK LHQQLGNRYV FTISTNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-191490479C-Myb DNA-Binding Domain
1mse_C5e-191490479C-Myb DNA-Binding Domain
1gv2_A5e-191490479MYB PROTO-ONCOGENE PROTEIN
1h8a_C8e-19149027102MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150399e-53AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015953561.13e-61PREDICTED: transcription repressor MYB6-like
SwissprotP200244e-41MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A0B2S3671e-52A0A0B2S367_GLYSO; Myb-related protein Myb4
TrEMBLK7KY774e-53K7KY77_SOYBN; Uncharacterized protein
STRINGGLYMA06G45531.11e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.12e-41myb domain protein 14